Structure of PDB 5fe5 Chain B

Receptor sequence

>5fe5B (length=109) Species: 9606 (Homo sapiens)

RDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKT
MSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFS
KIKEAGLID

3D structure

• PDB: 5fe5 Structure-Based Identification of Inhibitory Fragments Targeting the p300/CBP-Associated Factor Bromodomain.
• Chain: B
• Resolution: 2.12 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.48: histone acetyltransferase.
  2.3.1.57: diamine N-acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	2QC	B	P747 E756 Y802 N803 Y809	P25 E34 Y80 N81 Y87

Gene Ontology

Molecular Function

• GO:0004402 histone acetyltransferase activity

External links

• PDB: RCSB:5fe5, PDBe:5fe5, PDBj:5fe5
• PDBsum: 5fe5
• PubMed: 26731131
• UniProt: Q92831|KAT2B_HUMAN Histone acetyltransferase KAT2B (Gene Name=KAT2B)