Structure of PDB 5f99 Chain B

Receptor sequence
>5f99B (length=83) Species: 8355 (Xenopus laevis) [Search protein sequence]
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA
VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
3D structure
PDB5f99 X-ray structure of the MMTV-A nucleosome core.
ChainB
Resolution2.63 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B T30 R45 T11 R26
BS02 dna B R35 R45 I46 S47 G48 R78 K79 T80 R16 R26 I27 S28 G29 R59 K60 T61
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5f99, PDBe:5f99, PDBj:5f99
PDBsum5f99
PubMed26787910
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]