Structure of PDB 5f76 Chain B

Receptor sequence

>5f76B (length=289) Species: 6183 (Schistosoma mansoni)

KVKVGIIGGTGFDDPNLFKKVGVRQVTTPFGKPSDTLVEGFVGDVACVVL
PRHGKGHLIPPSEVNYRANVWALKDLGCTHILATNACGSLQEDLVPGDFV
VLNQFMDKTWGRENTFYGSKPDSLKGVLHMPMAEPFCERTRQILIQAARN
KSINVYDKKTMDKSACIHPCVHAEGSAVTINGPRFSTRCESFIHKAMGLD
IVNMTLVPEVSLAREAGLSYASIAIVTDFDCWKSEEEHVCVDMVLEQFRK
SVVHVREILLEAVALIGAEDWTKTIEANKALVMSSRQDL

3D structure

• PDB: 5f76 Crystal Structure of Schistosoma mansoni Adenosine Phosphorylase/5'-Methylthioadenosine Phosphorylase and Its Importance on Adenosine Salvage Pathway.
• Chain: B
• Resolution: 1.95 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K34 H59 D230 D232
• Catalytic site (residue number reindexed from 1): K32 H57 D228 D230
• Enzyme Commision number: 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MTA	B	A88 C89 G90 F187 N205 M206 D230 V246	A86 C87 G88 F185 N203 M204 D228 V244
BS02	MTA	B	H131 Q289	H129 Q287

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0016757 glycosyltransferase activity
• GO:0016763 pentosyltransferase activity
• GO:0017061 S-methyl-5-thioadenosine phosphorylase activity

Biological Process

• GO:0006166 purine ribonucleoside salvage
• GO:0009116 nucleoside metabolic process
• GO:0019509 L-methionine salvage from methylthioadenosine

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:5f76, PDBe:5f76, PDBj:5f76
• PDBsum: 5f76
• PubMed: 27935959
• UniProt: I0B503