Structure of PDB 5f6q Chain B

Receptor sequence

>5f6qB (length=140) Species: 1392 (Bacillus anthracis)

AMLQGINHICFSVSNLEKSIEFYQKILQAKLLVKGRKLAYFDLNGLWIAL
NVEEDIPRNEIKQSYTHMAFTVTNEALDHLKEVLIQNDVNILPGRERDER
DQRSLYFTDPDGHKFEFHTGTLQNRLEYYKEDKKHMTFYI

3D structure

• PDB: 5f6q Crystal Structure of Metallothiol Transferase from Bacillus anthracis str. Ames
• Chain: B
• Resolution: 1.52 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	H66 E115	H67 E116

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0016740 transferase activity
• GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
• GO:0046872 metal ion binding

Biological Process

• GO:0046677 response to antibiotic

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5f6q, PDBe:5f6q, PDBj:5f6q
• PDBsum: 5f6q
• UniProt: Q81W73|FOSB2_BACAN Metallothiol transferase FosB 2 (Gene Name=fosB2)