Structure of PDB 5f2u Chain B

Receptor sequence
>5f2uB (length=148) Species: 9606 (Homo sapiens) [Search protein sequence]
AKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKK
ILKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNST
NTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRLFYV
3D structure
PDB5f2u PDE6delta-mediated sorting of INPP5E into the cilium is determined by cargo-carrier affinity.
ChainB
Resolution1.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B L54 C56 E88 E110 A111 A112 Q116 M117 M118 Y149 L52 C54 E86 E108 A109 A110 Q114 M115 M116 Y147
BS02 FAR B M20 Q78 M18 Q76
Gene Ontology
Molecular Function
GO:0005095 GTPase inhibitor activity
GO:0005515 protein binding
GO:0031267 small GTPase binding
Biological Process
GO:0007601 visual perception
GO:0050953 sensory perception of light stimulus
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005929 cilium
GO:0016020 membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5f2u, PDBe:5f2u, PDBj:5f2u
PDBsum5f2u
PubMed27063844
UniProtO43924|PDE6D_HUMAN Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta (Gene Name=PDE6D)

[Back to BioLiP]