Structure of PDB 5eqd Chain B

Receptor sequence

>5eqdB (length=391) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

GNFDLFVVGSGFFGLTIAERAATQLGKRVLVIERRPHIGGNAYSEPEPET
GIEVHKYGAHLFHTSNKRVWDYVRQFTDFTGYQHRVFAMHNGQAYQFPMG
LGLVSQFFGRYFSPDEARALIAEQASEIDTKDAKNFEEKAISLVGRPLYE
AFIKHYTAKQWQTDPKDLPASNITRLPVRYTFDNRYFNDTYEGLPVEGYT
KWLENMAADERIEVRLDTDWFDVRDDLRAANPDAPVVYTGPLDRYFDYAE
GRLGWRTLDFELEVLETGDFQGTPVMNYNDLDVPYTRIHEFRHFHPERTY
PTDKTVIMREYSRFADNDDEPYYPINTEADRAVLAAYRARAKAETASAKV
LFGGRLGTYQYLDMHMAIASALSMFDNVLAPHLSEGASLVT

3D structure

• PDB: 5eqd Structural dynamics of UDP-galactopyranose mutase from Mycobacterium smegmatis
• Chain: B
• Resolution: 1.83 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R189 R193 R270 R301 E324 Y375 D377
• Catalytic site (residue number reindexed from 1): R175 R179 R256 R287 E310 Y361 D363
• Enzyme Commision number: 5.4.99.9: UDP-galactopyranose mutase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UDP	B	F111 I167 Y170 T171 W175 R189 L190 Y200 N291 R301 Y337 Y375	F97 I153 Y156 T157 W161 R175 L176 Y186 N277 R287 Y323 Y361
BS02	FAD	B	V22 G23 G25 F27 I46 E47 R48 R49 G54 N55 H74 L75 D233 W234 F235 G254 P255 Y336 G368 R369 D377 M378	V8 G9 G11 F13 I32 E33 R34 R35 G40 N41 H60 L61 D219 W220 F221 G240 P241 Y322 G354 R355 D363 M364

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008767 UDP-galactopyranose mutase activity
• GO:0016853 isomerase activity
• GO:0046872 metal ion binding
• GO:0050660 flavin adenine dinucleotide binding

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:5eqd, PDBe:5eqd, PDBj:5eqd
• PDBsum: 5eqd
• UniProt: A0R629