Structure of PDB 5ena Chain B

Receptor sequence
>5enaB (length=30) Species: 9606 (Homo sapiens) [Search protein sequence]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
3D structure
PDB5ena Crystallization of Enantiomerically Pure Proteins from Quasi-Racemic Mixtures: Structure Determination by X-Ray Diffraction of Isotope-Labeled Ester Insulin and Human Insulin.
ChainB
Resolution1.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B V2 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 P28 T30 V2 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 P28 T30
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5ena, PDBe:5ena, PDBj:5ena
PDBsum5ena
PubMed26707939
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]