Structure of PDB 5en9 Chain B

Receptor sequence
>5en9B (length=30) Species: 9606 (Homo sapiens) [Search protein sequence]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
3D structure
PDB5en9 Crystallization of Enantiomerically Pure Proteins from Quasi-Racemic Mixtures: Structure Determination by X-Ray Diffraction of Isotope-Labeled Ester Insulin and Human Insulin.
ChainB
Resolution1.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B V2 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 T30 V2 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 T30
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5en9, PDBe:5en9, PDBj:5en9
PDBsum5en9
PubMed26707939
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]