Structure of PDB 5emt Chain B

Receptor sequence

>5emtB (length=112) Species: 9606 (Homo sapiens)

GDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQIS
VAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLH
VLGGRQMHWPPG

3D structure

• PDB: 5emt Inhibition by divalent metal ions of human histidine triad nucleotide binding protein1 (hHint1), a regulator of opioid analgesia and neuropathic pain.
• Chain: B
• Resolution: 1.5 Å

Enzymatic activity

• Enzyme Commision number: 3.4.22.-
  3.9.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU	B	H59 H110	H45 H96

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003824 catalytic activity
• GO:0005080 protein kinase C binding
• GO:0005515 protein binding
• GO:0008234 cysteine-type peptidase activity
• GO:0016787 hydrolase activity
• GO:0016929 deSUMOylase activity
• GO:0043530 adenosine 5'-monophosphoramidase activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0006508 proteolysis
• GO:0006915 apoptotic process
• GO:0007165 signal transduction
• GO:0009154 purine ribonucleotide catabolic process
• GO:0016926 protein desumoylation
• GO:0050850 positive regulation of calcium-mediated signaling
• GO:0072332 intrinsic apoptotic signaling pathway by p53 class mediator

Cellular Component

• GO:0000118 histone deacetylase complex
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005856 cytoskeleton
• GO:0005886 plasma membrane
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:5emt, PDBe:5emt, PDBj:5emt
• PDBsum: 5emt
• PubMed: 28739258
• UniProt: P49773|HINT1_HUMAN Adenosine 5'-monophosphoramidase HINT1 (Gene Name=HINT1)