Structure of PDB 5emq Chain B

Receptor sequence

>5emqB (length=72) Species: 9606 (Homo sapiens)

PKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDK
IRRKNCPACRYRKCLQAGMNLE

3D structure

• PDB: 5emq The effects of cytosine methylation on general transcription factors
• Chain: B
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	S459 V462 R466 R489 K490 R496	S23 V26 R30 R53 K54 R60
BS02	dna	B	C450 H451 Y452 K461 K465	C14 H15 Y16 K25 K29
BS03	ZN	B	C440 C443 C457 C460	C4 C7 C21 C24
BS04	ZN	B	C476 C482 C492 C495	C40 C46 C56 C59

Gene Ontology

Molecular Function

• GO:0003700 DNA-binding transcription factor activity
• GO:0008270 zinc ion binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription

External links

• PDB: RCSB:5emq, PDBe:5emq, PDBj:5emq
• PDBsum: 5emq
• UniProt: P04150|GCR_HUMAN Glucocorticoid receptor (Gene Name=NR3C1)