Structure of PDB 5emp Chain B

Receptor sequence

>5empB (length=71) Species: 9606 (Homo sapiens)

KLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKI
RRKNCPACRYRKCLQAGMNLE

3D structure

• PDB: 5emp The effects of cytosine methylation on general transcription factors
• Chain: B
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	S459 R466 R489 K490 R496 L507 E508	S22 R29 R52 K53 R59 L70 E71
BS02	dna	B	C450 H451 Y452 K461 K465	C13 H14 Y15 K24 K28
BS03	ZN	B	C440 C443 C460	C3 C6 C23
BS04	ZN	B	C476 C482 C492 C495	C39 C45 C55 C58

Gene Ontology

Molecular Function

• GO:0003700 DNA-binding transcription factor activity
• GO:0008270 zinc ion binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription

External links

• PDB: RCSB:5emp, PDBe:5emp, PDBj:5emp
• PDBsum: 5emp
• UniProt: P04150|GCR_HUMAN Glucocorticoid receptor (Gene Name=NR3C1)