Structure of PDB 5elc Chain B

Receptor sequence

>5elcB (length=103) Species: 127906 (Vibrio cholerae O1)

TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQV
EVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAIS
MAN

3D structure

• PDB: 5elc High-Resolution Crystal Structures Elucidate the Molecular Basis of Cholera Blood Group Dependence.
• Chain: B
• Resolution: 1.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GAL	B	Y18 H94	Y18 H94
BS02	FUC	B	A46 I47 F48 H94	A46 I47 F48 H94

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0005534 galactose binding
• GO:0046812 host cell surface binding
• GO:0090729 toxin activity

Biological Process

• GO:0035821 modulation of process of another organism
• GO:0042531 positive regulation of tyrosine phosphorylation of STAT protein

Cellular Component

• GO:0005576 extracellular region
• GO:0016020 membrane
• GO:0020002 host cell plasma membrane
• GO:0042597 periplasmic space
• GO:1902494 catalytic complex

External links

• PDB: RCSB:5elc, PDBe:5elc, PDBj:5elc
• PDBsum: 5elc
• PubMed: 27082955
• UniProt: P01556|CHTB_VIBCH Cholera enterotoxin subunit B (Gene Name=ctxB)