Structure of PDB 5eg0 Chain B

Receptor sequence
>5eg0B (length=61) Species: 9606 (Homo sapiens) [Search protein sequence]
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQN
RRVKEKKVLAK
3D structure
PDB5eg0 Molecular basis of recognition of two distinct DNA sequences by a single transcription factor
ChainB
Resolution3.101 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B R217 R220 P222 Y223 Q259 I262 N266 K270 R1 R4 P6 Y7 Q43 I46 N50 K54
BS02 dna B R217 K219 R220 R268 K272 R1 K3 R4 R52 K56
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5eg0, PDBe:5eg0, PDBj:5eg0
PDBsum5eg0
PubMed
UniProtQ92826|HXB13_HUMAN Homeobox protein Hox-B13 (Gene Name=HOXB13)

[Back to BioLiP]