Structure of PDB 5ee5 Chain B

Receptor sequence

>5ee5B (length=164) Species: 9606 (Homo sapiens)

EMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVW
DLGGLTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEEL
RKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGL
DEAMEWLVETLKSR

3D structure

• PDB: 5ee5 Structural Insights into Arl1-Mediated Targeting of the Arf-GEF BIG1 to the trans-Golgi.
• Chain: B
• Resolution: 2.279 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): L71
• Catalytic site (residue number reindexed from 1): L55

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	B	D26 G27 G29 K30 T31 T32 T45 T48 G69 G70 N126 K127 D129 M130 S159 A160 T161	D10 G11 G13 K14 T15 T16 T29 T32 G53 G54 N110 K111 D113 M114 S143 A144 T145
BS02	MG	B	T31 T48 D67	T15 T32 D51
BS03	MG	B	D93 D96	D77 D80
BS04	MG	B	T57 Y58 L61	T41 Y42 L45
BS05	MG	B	T31 T48	T15 T32

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0008047 enzyme activator activity
• GO:0019904 protein domain specific binding
• GO:0046872 metal ion binding
• GO:1990583 phospholipase D activator activity

Biological Process

• GO:0006886 intracellular protein transport
• GO:0007030 Golgi organization
• GO:0009404 toxin metabolic process
• GO:0016192 vesicle-mediated transport
• GO:0034067 protein localization to Golgi apparatus
• GO:0042147 retrograde transport, endosome to Golgi

Cellular Component

• GO:0000139 Golgi membrane
• GO:0005737 cytoplasm
• GO:0005794 Golgi apparatus
• GO:0005802 trans-Golgi network
• GO:0005829 cytosol
• GO:0016020 membrane
• GO:0032588 trans-Golgi network membrane

External links

• PDB: RCSB:5ee5, PDBe:5ee5, PDBj:5ee5
• PDBsum: 5ee5
• PubMed: 27373159
• UniProt: P40616|ARL1_HUMAN ADP-ribosylation factor-like protein 1 (Gene Name=ARL1)