Structure of PDB 5e7w Chain B

Receptor sequence

>5e7wB (length=30) Species: 9606 (Homo sapiens)

FVNQHLCGSHLVEALYLVCGERGFFYTPKT

3D structure

• PDB: 5e7w Ultra-high resolution X-ray structures of two forms of human recombinant insulin at 100 K.
• Chain: B
• Resolution: 0.9519 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	F1 N3 Q4 H5 L6 C7 L11 V18 C19 R22 G23 F24 F25 Y26 P28 K29	F1 N3 Q4 H5 L6 C7 L11 V18 C19 R22 G23 F24 F25 Y26 P28 K29

Gene Ontology

Molecular Function

• GO:0005179 hormone activity

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:5e7w, PDBe:5e7w, PDBj:5e7w
• PDBsum: 5e7w
• PubMed: 29086855
• UniProt: P01308|INS_HUMAN Insulin (Gene Name=INS)