Structure of PDB 5e2b Chain B

Receptor sequence
>5e2bB (length=225) Species: 9606 (Homo sapiens) [Search protein sequence]
RGSTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKF
LQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLV
QAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAE
FLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAG
LSLLAEERQENLPDEIYHVYSFALR
3D structure
PDB5e2b Structural basis for substrate recognition by the human N-terminal methyltransferase 1.
ChainB
Resolution1.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.1.1.244: protein N-terminal methyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B W20 L31 G32 Y34 W136 D177 D180 E213 I214 Y215 W22 L33 G34 Y36 W138 D179 D182 E215 I216 Y217
BS02 SAH B W20 G69 G71 R74 I75 D91 I92 T93 F96 G118 L119 W136 V137 H140 W22 G71 G73 R76 I77 D93 I94 T95 F98 G120 L121 W138 V139 H142
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008276 protein methyltransferase activity
GO:0042054 histone methyltransferase activity
GO:0071885 N-terminal protein N-methyltransferase activity
Biological Process
GO:0006338 chromatin remodeling
GO:0006480 N-terminal protein amino acid methylation
GO:0007051 spindle organization
GO:0007059 chromosome segregation
GO:0018012 N-terminal peptidyl-alanine trimethylation
GO:0018013 N-terminal peptidyl-glycine methylation
GO:0018016 N-terminal peptidyl-proline dimethylation
GO:0032259 methylation
GO:0035572 N-terminal peptidyl-serine dimethylation
GO:0035573 N-terminal peptidyl-serine trimethylation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5e2b, PDBe:5e2b, PDBj:5e2b
PDBsum5e2b
PubMed26543161
UniProtQ9BV86|NTM1A_HUMAN N-terminal Xaa-Pro-Lys N-methyltransferase 1 (Gene Name=NTMT1)

[Back to BioLiP]