Structure of PDB 5dg2 Chain B

Receptor sequence

>5dg2B (length=131) Species: 9606 (Homo sapiens)

MTGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRF
SESTIVCNSLDGSNWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDG
HELTFPNRLGHSHLSYLSVRGGFNMSSFKLK

3D structure

• PDB: 5dg2 Human galectin-2 interacts with carbohydrates and peptides non-classically: new insight from X-ray crystallography and hemagglutination.
• Chain: B
• Resolution: 1.612 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GLC	B	R52 E71 R73	R49 E68 R70
BS02	GAL	B	H48 R52 W68 E71	H45 R49 W65 E68

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0016936 galactoside binding
• GO:0030246 carbohydrate binding

Biological Process

• GO:0043029 T cell homeostasis
• GO:0043065 positive regulation of apoptotic process
• GO:0050729 positive regulation of inflammatory response
• GO:0098609 cell-cell adhesion

Cellular Component

• GO:1990724 galectin complex

External links

• PDB: RCSB:5dg2, PDBe:5dg2, PDBj:5dg2
• PDBsum: 5dg2
• PubMed: 27563008
• UniProt: P05162|LEG2_HUMAN Galectin-2 (Gene Name=LGALS2)