Structure of PDB 5de2 Chain B

Receptor sequence
>5de2B (length=262) Species: 9606 (Homo sapiens) [Search protein sequence]
KALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFD
LMDAKARADCIKEIDLLKQLNHPNVIKFYASFIEDNELNIVLELADAGDL
SRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFI
TATGVVKLGDLPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYG
DKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYV
YDVAKRMHACTA
3D structure
PDB5de2 Mechanistic basis of Nek7 activation through Nek9 binding and induced dimerization.
ChainB
Resolution2.78 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D161 K163 A165 N166 D179
Catalytic site (residue number reindexed from 1) D142 K144 A146 N147 D160
Enzyme Commision number 2.7.11.34: NEK6-subfamily protein kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B G117 M122 H125 F126 R131 K140 Y141 I169 T170 A171 G98 M103 H106 F107 R112 K121 Y122 I150 T151 A152
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0044024 histone H2AS1 kinase activity
GO:0046872 metal ion binding
GO:0106310 protein serine kinase activity
GO:0140677 molecular function activator activity
Biological Process
GO:0006338 chromatin remodeling
GO:0006468 protein phosphorylation
GO:0007346 regulation of mitotic cell cycle
GO:0016310 phosphorylation
GO:0032206 positive regulation of telomere maintenance
GO:0035865 cellular response to potassium ion
GO:0051225 spindle assembly
GO:1900227 positive regulation of NLRP3 inflammasome complex assembly
Cellular Component
GO:0000922 spindle pole
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005815 microtubule organizing center
GO:0005856 cytoskeleton
GO:0005874 microtubule

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5de2, PDBe:5de2, PDBj:5de2
PDBsum5de2
PubMed26522158
UniProtQ8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 (Gene Name=NEK7)

[Back to BioLiP]