Structure of PDB 5dah Chain B

Receptor sequence

>5dahB (length=181) Species: 9606 (Homo sapiens) [Search protein sequence]

EMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQVPTGPWFCR
KCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVST
MEPIVLQSVPHDRYNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVT
CAQFAGLLCEEEADNVQYCGYCKYHFSKLKK

3D structure

PDB

5dah The PZP Domain of AF10 Senses Unmodified H3K27 to Regulate DOT1L-Mediated Methylation of H3K79.

Chain

Resolution

2.611 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	B	A54 C55 L107 I109 P110 F114 V117 M120 E179 D186 N187 V188 Y190	A35 C36 L88 I90 P91 F95 V98 M101 E160 D164 N165 V166 Y168
BS02	ZN	B	C25 C28 H52 C55	C6 C9 H33 C36
BS03	ZN	B	C42 C47 C68 C71	C23 C28 C49 C52
BS04	ZN	B	C82 C85 H102 C105	C63 C66 H83 C86
BS05	ZN	B	C137 C140 H167 C170	C118 C121 H148 C151
BS06	ZN	B	C157 C162 C194 H197	C138 C143 C172 H175

External links

PDB	RCSB:5dah, PDBe:5dah, PDBj:5dah
PDBsum	5dah
PubMed	26439302
UniProt	P55197\|AF10_HUMAN Protein AF-10 (Gene Name=MLLT10)

[Back to BioLiP]