Structure of PDB 5d3f Chain B

Receptor sequence

>5d3fB (length=224) Species: 9606 (Homo sapiens) [Search protein sequence]

DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNV
VGARRSSWRVVSSIEQKEKKQQMAREYREKIETELRDICNDVLSLLEKFL
IPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEI
SKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDT
LSEESYKDSTLIMQLLRDNLTLWT

3D structure

PDB

5d3f Characterization and small-molecule stabilization of the multisite tandem binding between 14-3-3 and the R domain of CFTR.

Chain

Resolution

2.74 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	R56 R129 Y130 L174 N175 E182 T207 S209 Y213 N226	R55 R122 Y123 L167 N168 E175 T200 S202 Y206 N219
BS02	FSC	B	N42 F119 K122 P167 D215 L218	N41 F112 K115 P160 D208 L211	BindingDB: Kd=700nM

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0019901	protein kinase binding
GO:0019904	protein domain specific binding
GO:0031625	ubiquitin protein ligase binding
GO:0042802	identical protein binding
GO:0044325	transmembrane transporter binding
GO:0045296	cadherin binding
GO:0050815	phosphoserine residue binding
GO:0140297	DNA-binding transcription factor binding
GO:0140311	protein sequestering activity

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0001525	angiogenesis
GO:0003016	respiratory system process
GO:0006468	protein phosphorylation
GO:0006605	protein targeting
GO:0007165	signal transduction
GO:0008039	synaptic target recognition
GO:0008104	protein localization
GO:0030324	lung development
GO:0031647	regulation of protein stability
GO:0035148	tube formation
GO:0042149	cellular response to glucose starvation
GO:0043066	negative regulation of apoptotic process
GO:0043067	regulation of programmed cell death
GO:0045824	negative regulation of innate immune response
GO:0051683	establishment of Golgi localization
GO:0070371	ERK1 and ERK2 cascade
GO:0070372	regulation of ERK1 and ERK2 cascade
GO:0090128	regulation of synapse maturation
GO:0090168	Golgi reassembly
GO:1900181	negative regulation of protein localization to nucleus
GO:1904262	negative regulation of TORC1 signaling

	Cellular Component
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005925	focal adhesion
GO:0031982	vesicle
GO:0042470	melanosome
GO:0070062	extracellular exosome
GO:0072562	blood microparticle
GO:0098686	hippocampal mossy fiber to CA3 synapse
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5d3f, PDBe:5d3f, PDBj:5d3f
PDBsum	5d3f
PubMed	26888287
UniProt	P63104\|1433Z_HUMAN 14-3-3 protein zeta/delta (Gene Name=YWHAZ)

[Back to BioLiP]