Structure of PDB 5d2c Chain B

Receptor sequence
>5d2cB (length=128) Species: 83334 (Escherichia coli O157:H7) [Search protein sequence]
ADKELKFLVVDDQSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGY
GFVISDWKMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQA
GASGYVVKPFTAATLEEKLNKIFEKLGM
3D structure
PDB5d2c Imidazole as a Small Molecule Analogue in Two-Component Signal Transduction.
ChainB
Resolution2.06 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MN B D13 D57 K59 D12 D56 K58
BS02 BEF B D57 W58 K59 T87 K109 D56 W57 K58 T86 K108
BS03 IMD B L46 G49 G50 Y51 L45 G48 G49 Y50
Gene Ontology
Molecular Function
GO:0000155 phosphorelay sensor kinase activity
GO:0009927 histidine phosphotransfer kinase activity
GO:0046872 metal ion binding
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006935 chemotaxis
GO:0046777 protein autophosphorylation
GO:0097588 archaeal or bacterial-type flagellum-dependent cell motility
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5d2c, PDBe:5d2c, PDBj:5d2c
PDBsum5d2c
PubMed26569142
UniProtP0AE68|CHEY_ECO57 Chemotaxis protein CheY (Gene Name=cheY)

[Back to BioLiP]