Structure of PDB 5d15 Chain B

Receptor sequence
>5d15B (length=164) Species: 1391991 (Mycobacterium avium subsp. avium 10-9275) [Search protein sequence]
MGSRVVILFTDIEESTALNERIGDRAWVKLISSHDKLVSDLVRRQSGHVV
KSQGDGFMVAFARPEQAVRCGIELQRALRRNANEIRVRIGIHMGRSVRRG
DDLFGRNVAMAARVAAQAAGGEILVSQPVRDALSRSDGIRFDDGREVELK
GFSGTYRLFAVLAS
3D structure
PDB5d15 Substrate specificity determinants of class III nucleotidyl cyclases
ChainB
Resolution1.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ATP B K153 D209 L210 F211 V215 K257 K51 D102 L103 F104 V108 K150
BS02 ATP B D113 I114 E115 E116 S117 T118 G156 D157 R195 D11 I12 E13 E14 S15 T16 G54 D55 R88
BS03 CA B D113 I114 D157 D11 I12 D55
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 16 15:41:54 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5d15', asym_id = 'B', title = 'Substrate specificity determinants of class III nucleotidyl cyclases'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5d15', asym_id='B', title='Substrate specificity determinants of class III nucleotidyl cyclases')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0009190,0035556', uniprot = '', pdbid = '5d15', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009190,0035556', uniprot='', pdbid='5d15', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>