Structure of PDB 5cx3 Chain B

Receptor sequence
>5cx3B (length=118) Species: 9606 (Homo sapiens) [Search protein sequence]
DRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFL
VPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEK
DEDGFLYMVYASQETFGF
3D structure
PDB5cx3 Structural basis of FYCO1 and MAP1LC3A interaction reveals a novel binding mode for Atg8-family proteins.
ChainB
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B R10 R11 E19 I23 D48 K49 T50 K51 F52 L53 P55 E62 I66 R69 R70 R7 R8 E16 I20 D45 K46 T47 K48 F49 L50 P52 E59 I63 R66 R67
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005543 phospholipid binding
GO:0008017 microtubule binding
GO:0008429 phosphatidylethanolamine binding
GO:0031625 ubiquitin protein ligase binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0007254 JNK cascade
GO:0009267 cellular response to starvation
GO:0010040 response to iron(II) ion
GO:0010288 response to lead ion
GO:0016236 macroautophagy
GO:0031667 response to nutrient levels
GO:0034198 cellular response to amino acid starvation
GO:0038066 p38MAPK cascade
GO:0060395 SMAD protein signal transduction
GO:0070301 cellular response to hydrogen peroxide
GO:0071280 cellular response to copper ion
GO:0090650 cellular response to oxygen-glucose deprivation
GO:0097352 autophagosome maturation
Cellular Component
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005770 late endosome
GO:0005776 autophagosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0012505 endomembrane system
GO:0016020 membrane
GO:0031090 organelle membrane
GO:0031410 cytoplasmic vesicle
GO:0043231 intracellular membrane-bounded organelle
GO:0044754 autolysosome
GO:0045202 synapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5cx3, PDBe:5cx3, PDBj:5cx3
PDBsum5cx3
PubMed27246247
UniProtQ9H492|MLP3A_HUMAN Microtubule-associated proteins 1A/1B light chain 3A (Gene Name=MAP1LC3A)

[Back to BioLiP]