Structure of PDB 5crl Chain B |
>5crlB (length=119) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
NLTIGVFAKAAGVNVETIRFYQRKGLLLRRYGEADVTRVRFVKSAQRLGF SLDEIAELLRLEDGTHCEEASSLAEHKLKDVREKMADLARMEAVLSELVC ACHARRGNVSCPLIASLQG |
|
PDB | 5crl Structural Analysis of the Hg(II)-Regulatory Protein Tn501 MerR from Pseudomonas aeruginosa. |
Chain | B |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
HG |
B |
C117 C126 |
C102 C111 |
|
|
|
|