Structure of PDB 5clp Chain B

Receptor sequence

>5clpB (length=327) Species: 9606 (Homo sapiens)

GPVPSRARVYTDVNTHRPSEYWDYESHVVEWGNQDDYQLVRKLGRGKYSE
VFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVK
DPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGI
MHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPEL
LVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTE
DLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLD
KLLRYDHQSRLTAREAMEHPYFYTVVK

3D structure

• PDB: 5clp Specific inhibition of CK2 alpha from an anchor outside the active site.
• Chain: B
• Resolution: 1.684 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D156 K158 N161 D175 P184 S194
• Catalytic site (residue number reindexed from 1): D154 K156 N159 D173 P182 S192
• Enzyme Commision number: 2.7.11.1: non-specific serine/threonine protein kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	42J	B	V66 K68 M163 I174 D175	V64 K66 M161 I172 D173	BindingDB: IC50=700000nM
BS02	42J	B	H160 N161 M163 D175	H158 N159 M161 D173	BindingDB: IC50=700000nM
BS03	42J	B	L128 P159 V162 I164 M221 M225	L126 P157 V160 I162 M219 M223	BindingDB: IC50=700000nM
BS04	42J	B	Q36 D37 Y39 L41 V67 I69	Q34 D35 Y37 L39 V65 I67	BindingDB: IC50=700000nM
BS05	42J	B	N16 T17 W24 H183 Q186	N14 T15 W22 H181 Q184	BindingDB: IC50=700000nM

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004674 protein serine/threonine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation

External links

• PDB: RCSB:5clp, PDBe:5clp, PDBj:5clp
• PDBsum: 5clp
• PubMed: 28451126
• UniProt: P68400|CSK21_HUMAN Casein kinase II subunit alpha (Gene Name=CSNK2A1)