Structure of PDB 5cg2 Chain B

Receptor sequence
>5cg2B (length=239) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEF
AAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLD
GDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAER
AIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPICEAVTPIRR
TVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
3D structure
PDB5cg2 Crystallographic insights into the structure-activity relationships of diazaborine enoyl-ACP reductase inhibitors.
ChainB
Resolution2.11 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) M127 S145 Y156 M159 K163
Catalytic site (residue number reindexed from 1) M126 S144 Y155 M158 K162
Enzyme Commision number 1.3.1.9: enoyl-[acyl-carrier-protein] reductase (NADH).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAD B G13 S19 I20 Q40 D64 V65 S91 I92 S145 K163 A189 G190 P191 I192 G12 S18 I19 Q39 D63 V64 S90 I91 S144 K162 A188 G189 P190 I191
BS02 CJ3 B G93 Y146 Y156 M159 K163 G92 Y145 Y155 M158 K162
Gene Ontology
Molecular Function
GO:0004318 enoyl-[acyl-carrier-protein] reductase (NADH) activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0042802 identical protein binding
GO:0070404 NADH binding
Biological Process
GO:0006633 fatty acid biosynthetic process
GO:0008610 lipid biosynthetic process
GO:0009102 biotin biosynthetic process
GO:0030497 fatty acid elongation
GO:0046677 response to antibiotic
GO:0051289 protein homotetramerization
Cellular Component
GO:0005829 cytosol
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:1902494 catalytic complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5cg2, PDBe:5cg2, PDBj:5cg2
PDBsum5cg2
PubMed26625295
UniProtP0AEK4|FABI_ECOLI Enoyl-[acyl-carrier-protein] reductase [NADH] FabI (Gene Name=fabI)

[Back to BioLiP]