Structure of PDB 5cby Chain B

Receptor sequence
>5cbyB (length=72) Species: 32644 (unidentified) [Search protein sequence]
PKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDK
IRRKNCPACRFRKCLQAGMNLE
3D structure
PDB5cby Distal substitutions drive divergent DNA specificity among paralogous transcription factors through subdivision of conformational space.
ChainB
Resolution1.997 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B S440 R447 R470 K471 R477 S23 R30 R53 K54 R60 PDBbind-CN: Kd=0.119uM
BS02 dna B C431 H432 Y433 K446 C14 H15 Y16 K29 PDBbind-CN: Kd=0.119uM
BS03 ZN B C421 C424 C441 C4 C7 C24
BS04 ZN B C457 C463 C473 C476 C40 C46 C56 C59
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5cby, PDBe:5cby, PDBj:5cby
PDBsum5cby
PubMed26715749
UniProtP04150|GCR_HUMAN Glucocorticoid receptor (Gene Name=NR3C1)

[Back to BioLiP]