Structure of PDB 5c93 Chain B

Receptor sequence
>5c93B (length=221) Species: 1327988 (Lactiplantibacillus plantarum 16) [Search protein sequence]
KQFVSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRM
IRMINELLSLSRTRVDMELVNINEMFNYVLDRFDMILKKDDNPAKYYTIK
REFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVI
ISISDQGLGIPRADLGHVFDRFFRVDKARSQGGTGLGLAISKEVVQMLGG
RIWVDSVEGKGSTFYISLPYE
3D structure
PDB5c93 Conformational dynamics of the essential sensor histidine kinase WalK.
ChainB
Resolution2.518 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ACP B H391 N513 N514 K517 Y518 D542 L545 G546 I547 R561 G572 G574 L575 G576 L577 H9 N126 N127 K130 Y131 D155 L158 G159 I160 R174 G183 G185 L186 G187 L188
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Feb 22 11:56:58 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5c93', asym_id = 'B', title = 'Conformational dynamics of the essential sensor histidine kinase WalK.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5c93', asym_id='B', title='Conformational dynamics of the essential sensor histidine kinase WalK.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0000155,0007165,0016310,0016772', uniprot = '', pdbid = '5c93', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000155,0007165,0016310,0016772', uniprot='', pdbid='5c93', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>