Structure of PDB 5bwr Chain B

Receptor sequence
>5bwrB (length=358) Species: 9606 (Homo sapiens) [Search protein sequence]
SSSFKAADLQLEMTQKPHKKPGEPLVFGKTFTDHMLMVEWNDKGWGQPRI
QPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRPWLNMDRMLRS
AMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSL
GVSQPTRALLFVILCPVGAGSVTPVSLLADPAFIRAWVGGVGNYKLGGNY
GPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGVLELV
TPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVRE
VFGSGTACQVCPVHRILYKDRNLHIPTMENGPELILRFQKELKEIQYGIR
AHEWMFPV
3D structure
PDB5bwr The Discovery of in Vivo Active Mitochondrial Branched-Chain Aminotransferase (BCATm) Inhibitors by Hybridizing Fragment and HTS Hits.
ChainB
Resolution2.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K202
Catalytic site (residue number reindexed from 1) K195
Enzyme Commision number 2.6.1.42: branched-chain-amino-acid transaminase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 4VT B Y70 V155 Y67 V152 MOAD: ic50=25uM
BindingDB: IC50=25119nM
BS02 PLP B R99 R192 K202 Y207 E237 T240 M241 N242 L266 G268 V269 V270 T313 R96 R185 K195 Y200 E230 T233 M234 N235 L259 G261 V262 V263 T306
BS03 4VT B F30 F75 K202 T240 M241 G312 A314 C315 F27 F72 K195 T233 M234 G305 A307 C308 MOAD: ic50=25uM
BindingDB: IC50=25119nM
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0004084 branched-chain-amino-acid transaminase activity
GO:0005515 protein binding
GO:0008483 transaminase activity
GO:0052654 L-leucine-2-oxoglutarate transaminase activity
GO:0052655 L-valine-2-oxoglutarate transaminase activity
GO:0052656 L-isoleucine-2-oxoglutarate transaminase activity
Biological Process
GO:0006549 isoleucine metabolic process
GO:0006550 isoleucine catabolic process
GO:0006551 L-leucine metabolic process
GO:0006573 valine metabolic process
GO:0006629 lipid metabolic process
GO:0008652 amino acid biosynthetic process
GO:0009081 branched-chain amino acid metabolic process
GO:0009082 branched-chain amino acid biosynthetic process
GO:0009083 branched-chain amino acid catabolic process
GO:0009098 L-leucine biosynthetic process
GO:0009099 L-valine biosynthetic process
GO:0010817 regulation of hormone levels
GO:1990830 cellular response to leukemia inhibitory factor
Cellular Component
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5bwr, PDBe:5bwr, PDBj:5bwr
PDBsum5bwr
PubMed26090771
UniProtO15382|BCAT2_HUMAN Branched-chain-amino-acid aminotransferase, mitochondrial (Gene Name=BCAT2)

[Back to BioLiP]