Structure of PDB 5bvs Chain B

Receptor sequence
>5bvsB (length=132) Species: 30457 (Pygoscelis papua) [Search protein sequence]
MCDQFVGTWKFLSSENFEDYMKELGVGFATRKMAGVAKPNVTISINGDVI
TIKTESTFKNTEVSFRLGEEFDETTADDRKTKNVITLDNGILNQVQKWDG
KETVIKRKVMDGNLVVECTMNTVTSKRVYERA
3D structure
PDB5bvs Structural basis for the ligand-binding specificity of fatty acid-binding proteins (pFABP4 and pFABP5) in gentoo penguin
ChainB
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 EIC B F17 A34 P39 T57 F58 D77 R127 Y129 F17 A34 P39 T57 F58 D77 R127 Y129
Gene Ontology
Molecular Function
GO:0005324 long-chain fatty acid transmembrane transporter activity
GO:0005504 fatty acid binding
GO:0008289 lipid binding
GO:0070538 oleic acid binding
GO:0070539 linoleic acid binding
GO:0070540 stearic acid binding
Biological Process
GO:0015908 fatty acid transport
GO:0015909 long-chain fatty acid transport
GO:0071399 cellular response to linoleic acid
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5bvs, PDBe:5bvs, PDBj:5bvs
PDBsum5bvs
PubMed26206084
UniProtA0A0K0MJN3|FABP4_PYGPA Fatty acid-binding protein, adipocyte (Gene Name=FABP4)

[Back to BioLiP]