Structure of PDB 5bu7 Chain B

Receptor sequence

>5bu7B (length=106) Species: 562 (Escherichia coli)

ADLEDNMETLNDNLKVIEKADNAAQVEKALEKMLAAAADALKATPPKLED
KSPDSPEMHDFRHGFAILMGQIHDAAHLANEGKVKEAQAAAEQLKCTCNA
CHQKYR

3D structure

• PDB: 5bu7 Designed, Helical Protein Nanotubes with Tunable Diameters from a Single Building Block.
• Chain: B
• Resolution: 2.46 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	E4 M7 N11 F61 F65 C98 C101 H102 R106	E4 M7 N11 F61 F65 C98 C101 H102 R106
BS02	ZN	B	H73 H77	H73 H77
BS03	ZN	B	A1 D39	A1 D39
BS04	ZN	B	E27 E31	E27 E31

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:5bu7, PDBe:5bu7, PDBj:5bu7
• PDBsum: 5bu7
• UniProt: P0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)