Structure of PDB 5bti Chain B

Receptor sequence

>5btiB (length=245) Species: 83332 (Mycobacterium tuberculosis H37Rv)

ALVRRKGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAILP
LRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLM
ADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEF
AYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKELWETTMDPSV
RVLRQVTLDDAAAADELFSILMGEDVDARRSFITRNAKDVRFLDV

3D structure

• PDB: 5bti Crystal structure and stability of gyrase-fluoroquinolone cleaved complexes from Mycobacterium tuberculosis.
• Chain: B
• Resolution: 2.501 Å

Enzymatic activity

• Enzyme Commision number: 5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	E459 D461 D536	E29 D31 D106
BS02	dna	B	K484 I486 N487 K490 R495 N499 H539 V656 R659	K54 I56 N57 K60 R65 N69 H109 V226 R229
BS03	dna	B	E459 D461 G483 K484 D536	E29 D31 G53 K54 D106
BS04	dna	B	K484 I486 N487 K490 R495 N499 H539 V656 R659	K54 I56 N57 K60 R65 N69 H109 V226 R229
BS05	MG	B	D532 D534	D102 D104

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003918 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
• GO:0005524 ATP binding

Biological Process

• GO:0006265 DNA topological change

External links

• PDB: RCSB:5bti, PDBe:5bti, PDBj:5bti
• PDBsum: 5bti
• PubMed: 26792525
• UniProt: P9WG45|GYRB_MYCTU DNA gyrase subunit B (Gene Name=gyrB)