Structure of PDB 5bs7 Chain B |
>5bs7B (length=76) Species: 8355 (Xenopus laevis) [Search protein sequence] |
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL CAIHAKRVTIMPKDIQLARRIRGERA |
|
PDB | 5bs7 Structure-function studies of histone H3/H4 tetramer maintenance during transcription by chaperone Spt2. |
Chain | B |
Resolution | 3.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
A95 A98 |
A36 A39 |
|
|
|
|