Structure of PDB 5azf Chain B

Receptor sequence
>5azfB (length=119) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]
GPHMKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKK
KYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQD
HHEEDLFLYIAYSDESVYG
3D structure
PDB5azf Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy.
ChainB
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B I21 R28 P30 K46 K48 Y49 L50 P52 R67 F104 I24 R31 P33 K49 K51 Y52 L53 P55 R70 F107
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008429 phosphatidylethanolamine binding
GO:0031625 ubiquitin protein ligase binding
GO:0050811 GABA receptor binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0001778 plasma membrane repair
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0008340 determination of adult lifespan
GO:0009408 response to heat
GO:0012501 programmed cell death
GO:0016236 macroautophagy
GO:0040024 dauer larval development
GO:0050830 defense response to Gram-positive bacterium
GO:0070266 necroptotic process
GO:0097237 cellular response to toxic substance
GO:0097352 autophagosome maturation
GO:0098792 xenophagy
GO:2000786 positive regulation of autophagosome assembly
Cellular Component
GO:0000407 phagophore assembly site
GO:0000421 autophagosome membrane
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005741 mitochondrial outer membrane
GO:0005764 lysosome
GO:0005776 autophagosome
GO:0005886 plasma membrane
GO:0030425 dendrite
GO:0030670 phagocytic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0042995 cell projection
GO:0043005 neuron projection
GO:0043025 neuronal cell body
GO:0043202 lysosomal lumen
GO:0043204 perikaryon

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5azf, PDBe:5azf, PDBj:5azf
PDBsum5azf
PubMed26687600
UniProtQ09490|LGG1_CAEEL Protein lgg-1 (Gene Name=lgg-1)

[Back to BioLiP]