Structure of PDB 5awi Chain B

Receptor sequence

>5awiB (length=106) Species: 562 (Escherichia coli)

ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLED
KSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNA
CHQKYR

3D structure

• PDB: 5awi Domain-swapped cytochrome cb562 dimer and its nanocage encapsulating a Zn-SO4 cluster in the internal cavity
• Chain: B
• Resolution: 1.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	B	E4 M7 N11 P46	E4 M7 N11 P46
BS02	HEC	B	G64 F65 C98 C101 H102 R106	G64 F65 C98 C101 H102 R106
BS03	ZN	B	E4 D5	E4 D5
BS04	ZN	B	A1 D39	A1 D39

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:5awi, PDBe:5awi, PDBj:5awi
• PDBsum: 5awi
• UniProt: P0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)