Structure of PDB 5aox Chain B

Receptor sequence
>5aoxB (length=86) Species: 9606 (Homo sapiens) [Search protein sequence]
GAMESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIFEPADNKCLLR
ATDGKKKISTVVSSKEVNKFQMAYSNLLRANMDGLK
3D structure
PDB5aox Retrotransposition and Crystal Structure of an Alu Rnp in the Ribosome-Stalling Conformation.
ChainB
Resolution2.04 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B G2 G24 S25 Y27 K31 Y33 R36 T37 K38 P39 R59 K64 K66 G1 G23 S24 Y26 K30 Y32 R35 T36 K37 P38 R50 K55 K57
Gene Ontology
Molecular Function
GO:0008312 7S RNA binding
GO:0030942 endoplasmic reticulum signal peptide binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0005786 signal recognition particle, endoplasmic reticulum targeting
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5aox, PDBe:5aox, PDBj:5aox
PDBsum5aox
PubMed26585389
UniProtP37108|SRP14_HUMAN Signal recognition particle 14 kDa protein (Gene Name=SRP14)

[Back to BioLiP]