Structure of PDB 5a78 Chain B

Receptor sequence
>5a78B (length=158) Species: 3077 (Chlorella vulgaris) [Search protein sequence]
NFHDQLKFAWLAGFVDADGCINAQIVSREDYLLKYQVRVSLTVFQSTTQH
FILLDIQKILGCGTVRKRNDGMSEFCVVGGTSLQTTLEKLLPYLQLKRAQ
AKLVLQIIKKLPNTKDPSVLMEAALLADKVGLLTDGKKRTILAENVRECL
KKLGHVVS
3D structure
PDB5a78 Crystal Structure of the Homing Endonuclease I-Cvui Provides a New Template for Genome Modification
ChainB
Resolution2.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) A22 D23
Catalytic site (residue number reindexed from 1) A17 D18
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B D35 Y36 L37 Q41 R71 R73 N74 D75 G84 K143 D30 Y31 L32 Q36 R66 R68 N69 D70 G79 K138
BS02 dna B D23 C25 N27 Q29 R33 R43 F49 Q50 S51 R73 M77 G141 K143 R144 I146 D18 C20 N22 Q24 R28 R38 F44 Q45 S46 R68 M72 G136 K138 R139 I141
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5a78, PDBe:5a78, PDBj:5a78
PDBsum5a78
PubMed26363068
UniProtP56347|DNE1_CHLVU DNA endonuclease I-CvuI

[Back to BioLiP]