Structure of PDB 5a77 Chain B

Receptor sequence
>5a77B (length=158) Species: 3077 (Chlorella vulgaris) [Search protein sequence]
NFHDQLKFAWLAGFVDADGCINAQIVSREDYLLKYQVRVSLTVFQSTTQH
FILLDIQKILGCGTVRKRNDGMSEFCVVGGTSLQTTLEKLLPYLQLKRAQ
AKLVLQIIKKLPNTKDPSVLMEAALLADKVGLLTDGKKRTILAENVRECL
KKLGHVVS
3D structure
PDB5a77 Crystal Structure of the Homing Endonuclease I-Cvui Provides a New Template for Genome Modification
ChainB
Resolution2.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) A22 D23
Catalytic site (residue number reindexed from 1) A17 D18
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B R33 D35 Y36 L37 Q41 R71 R73 N74 D75 G84 K120 R28 D30 Y31 L32 Q36 R66 R68 N69 D70 G79 K115 PDBbind-CN: Kd=315nM
BS02 dna B D23 Q50 S51 M77 D18 Q45 S46 M72 PDBbind-CN: Kd=315nM
BS03 dna B A22 G24 C25 N27 R33 R43 F49 R73 K102 T139 G141 K143 R144 I146 A17 G19 C20 N22 R28 R38 F44 R68 K97 T134 G136 K138 R139 I141 PDBbind-CN: Kd=315nM
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5a77, PDBe:5a77, PDBj:5a77
PDBsum5a77
PubMed26363068
UniProtP56347|DNE1_CHLVU DNA endonuclease I-CvuI

[Back to BioLiP]