Structure of PDB 5a74 Chain B

Receptor sequence

>5a74B (length=158) Species: 3077 (Chlorella vulgaris) [Search protein sequence]

NFHDQLKFAWLAGFVDADGCINAQIVSREDYLLKYQVRVSLTVFQSTTQH
FILLDIQKILGCGTVRKRNDGMSEFCVVGGTSLQTTLEKLLPYLQLKRAQ
AKLVLQIIKKLPNTKDPSVLMEAALLADKVGLLTDGKKRTILAENVRECL
KKLGHVVS

3D structure

PDB

5a74 Crystal Structure of the Homing Endonuclease I-Cvui Provides a New Template for Genome Modification

Chain

Resolution

2.5 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	A22 D23
Catalytic site (residue number reindexed from 1)	A17 D18
Enzyme Commision number	3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	B	R33 D35 Y36 L37 Q41 R71 R73 N74 D75 G84 K143	R28 D30 Y31 L32 Q36 R66 R68 N69 D70 G79 K138
BS02	dna	B	D23 F49 Q50 S51 M77	D18 F44 Q45 S46 M72
BS03	dna	B	A22 D23 G24 C25 Q29 R43 F49 R73 T139 D140 G141 R144 I146	A17 D18 G19 C20 Q24 R38 F44 R68 T134 D135 G136 R139 I141
BS04	MN	B	D23 Q50	D18 Q45

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity

	Biological Process
GO:0006314	intron homing

	Cellular Component
GO:0009507	chloroplast

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5a74, PDBe:5a74, PDBj:5a74
PDBsum	5a74
PubMed	26363068
UniProt	P56347\|DNE1_CHLVU DNA endonuclease I-CvuI

[Back to BioLiP]