Structure of PDB 5a50 Chain B

Receptor sequence

>5a50B (length=165) Species: 3702 (Arabidopsis thaliana)

MDDLLGLLRIRIKRGVNLAVRDISSSDPYVVVKMGSQKLKTRVINKDVNP
EWNEDLTLSVTDSNLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALRMQ
LDGLPSGTIVTTVKPSRRNCLAEESRVTWVDGKLVQDLVLRLRHVECGEV
EAQLQWIDLPGSSGL

3D structure

• PDB: 5a50 Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
• Chain: B
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	B	D51 D56 D102 H103 D104	D22 D27 D73 H74 D75
BS02	CA	B	R50 D51 D102 D104 D110	R21 D22 D73 D75 D81
BS03	PC	B	K67 K69 Y101	K38 K40 Y72
BS04	ZN	B	H103 D109	H74 D80
BS05	PC	B	Y58 K69 T70 R71 V72 H103 D109	Y29 K40 T41 R42 V43 H74 D80

Gene Ontology

Molecular Function

• GO:0005096 GTPase activator activity
• GO:0005509 calcium ion binding
• GO:0005515 protein binding
• GO:0005543 phospholipid binding
• GO:0008289 lipid binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006952 defense response
• GO:0009651 response to salt stress
• GO:0009738 abscisic acid-activated signaling pathway
• GO:0009789 positive regulation of abscisic acid-activated signaling pathway
• GO:1900426 positive regulation of defense response to bacterium
• GO:1901002 positive regulation of response to salt stress

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005886 plasma membrane

External links

• PDB: RCSB:5a50, PDBe:5a50, PDBj:5a50
• PDBsum: 5a50
• PubMed: 26719420
• UniProt: Q9LVH4|CAR4_ARATH Protein C2-DOMAIN ABA-RELATED 4 (Gene Name=CAR4)