Structure of PDB 5a31 Chain B

Receptor sequence

>5a31B (length=84) Species: 9606 (Homo sapiens) [Search protein sequence]

MKVKIKCWNGVALWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQ
CSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE

3D structure

PDB

5a31 Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.

Chain

Resolution

4.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	ZN	B	C23 C26 H56 C59	C23 C26 H56 C59
BS02	ZN	B	C51 H53 C73 C76	C51 H53 C73 C76
BS03	ZN	B	C37 C44 H58	C37 C44 H58

Gene Ontology

	Molecular Function
GO:0004842	ubiquitin-protein transferase activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0034450	ubiquitin-ubiquitin ligase activity
GO:0046872	metal ion binding
GO:0061630	ubiquitin protein ligase activity
GO:0097602	cullin family protein binding

	Biological Process
GO:0000278	mitotic cell cycle
GO:0006511	ubiquitin-dependent protein catabolic process
GO:0007346	regulation of mitotic cell cycle
GO:0016567	protein ubiquitination
GO:0031145	anaphase-promoting complex-dependent catabolic process
GO:0045842	positive regulation of mitotic metaphase/anaphase transition
GO:0051301	cell division
GO:0051445	regulation of meiotic cell cycle
GO:0070936	protein K48-linked ubiquitination
GO:0070979	protein K11-linked ubiquitination
GO:0141198	protein branched polyubiquitination

External links

PDB	RCSB:5a31, PDBe:5a31, PDBj:5a31
PDBsum	5a31
PubMed	26083744
UniProt	Q9NYG5\|APC11_HUMAN Anaphase-promoting complex subunit 11 (Gene Name=ANAPC11)