Structure of PDB 4ztd Chain B

Receptor sequence

>4ztdB (length=253) Species: 9606 (Homo sapiens) [Search protein sequence]

FEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLT
LRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLAL
VFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDL
SHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNE
PVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYL
APK

3D structure

PDB

4ztd TRAIP is a PCNA-binding ubiquitin ligase that protects genome stability after replication stress.

Chain

Resolution

2.199 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	M40 H44 V45 L47 Q125 G127 P129 P234 A252 P253 K254	M39 H43 V44 L46 Q124 G126 P128 P233 A251 P252 K253

Gene Ontology

	Molecular Function
GO:0000701	purine-specific mismatch base pair DNA N-glycosylase activity
GO:0003677	DNA binding
GO:0003682	chromatin binding
GO:0003684	damaged DNA binding
GO:0005515	protein binding
GO:0019899	enzyme binding
GO:0030331	nuclear estrogen receptor binding
GO:0030337	DNA polymerase processivity factor activity
GO:0030971	receptor tyrosine kinase binding
GO:0032139	dinucleotide insertion or deletion binding
GO:0032405	MutLalpha complex binding
GO:0035035	histone acetyltransferase binding
GO:0042802	identical protein binding
GO:0044877	protein-containing complex binding
GO:0070182	DNA polymerase binding

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0006260	DNA replication
GO:0006272	leading strand elongation
GO:0006275	regulation of DNA replication
GO:0006281	DNA repair
GO:0006287	base-excision repair, gap-filling
GO:0006298	mismatch repair
GO:0006979	response to oxidative stress
GO:0007507	heart development
GO:0019985	translesion synthesis
GO:0030855	epithelial cell differentiation
GO:0031297	replication fork processing
GO:0032077	positive regulation of deoxyribonuclease activity
GO:0032355	response to estradiol
GO:0033993	response to lipid
GO:0034644	cellular response to UV
GO:0044849	estrous cycle
GO:0045739	positive regulation of DNA repair
GO:0045740	positive regulation of DNA replication
GO:0046686	response to cadmium ion
GO:0070301	cellular response to hydrogen peroxide
GO:0071466	cellular response to xenobiotic stimulus
GO:0071548	response to dexamethasone
GO:0097421	liver regeneration
GO:1900264	positive regulation of DNA-directed DNA polymerase activity
GO:1902065	response to L-glutamate
GO:1902990	mitotic telomere maintenance via semi-conservative replication

	Cellular Component
GO:0000307	cyclin-dependent protein kinase holoenzyme complex
GO:0000781	chromosome, telomeric region
GO:0000785	chromatin
GO:0001673	male germ cell nucleus
GO:0005634	nucleus
GO:0005652	nuclear lamina
GO:0005654	nucleoplasm
GO:0005657	replication fork
GO:0005813	centrosome
GO:0016604	nuclear body
GO:0030894	replisome
GO:0043596	nuclear replication fork
GO:0043626	PCNA complex
GO:0070062	extracellular exosome
GO:0070557	PCNA-p21 complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4ztd, PDBe:4ztd, PDBj:4ztd
PDBsum	4ztd
PubMed	26711499
UniProt	P12004\|PCNA_HUMAN Proliferating cell nuclear antigen (Gene Name=PCNA)

[Back to BioLiP]