Structure of PDB 4zoj Chain B

Receptor sequence

>4zojB (length=341) Species: 419947 (Mycobacterium tuberculosis H37Ra)

PSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAP
TADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAI
VVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGI
GFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFA
DLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTF
DPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAI
VAHAGLEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQ

3D structure

• PDB: 4zoj Inhibitor bound in the active site of Mycobacterium tuberculosis anthranilate phosphoribosyltransferase (AnPRT; trpD).
• Chain: B
• Resolution: 1.96 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): V106
• Catalytic site (residue number reindexed from 1): V82
• Enzyme Commision number: 2.4.2.18: anthranilate phosphoribosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	B	S119 E252	S95 E228
BS02	MG	B	D251 E252	D227 E228
BS03	PRP	B	G109 G110 N117 S119 T120 K135 A140 A141 S143	G85 G86 N93 S95 T96 K111 A116 A117 S119
BS04	61L	B	N138 A179 H183 Y186 G206	N114 A155 H159 Y162 G182

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004048 anthranilate phosphoribosyltransferase activity
• GO:0016757 glycosyltransferase activity
• GO:0016763 pentosyltransferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0000162 tryptophan biosynthetic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4zoj, PDBe:4zoj, PDBj:4zoj
• PDBsum: 4zoj
• UniProt: A5U4M0|TRPD_MYCTA Anthranilate phosphoribosyltransferase (Gene Name=trpD)