Structure of PDB 4zn1 Chain B |
>4zn1B (length=59) Species: 243232 (Methanocaldococcus jannaschii DSM 2661) [Search protein sequence] |
PRACLKCKYLTNDEICPICHSPTSENWIGLLIVINPEKSEIAKKAGIDIK GKYALSVKE |
|
PDB | 4zn1 Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII |
Chain | B |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
C4 C7 C16 |
C4 C7 C16 |
|
|
|
|