Structure of PDB 4zm2 Chain B

Receptor sequence
>4zm2B (length=61) Species: 10678 (Punavirus P1) [Search protein sequence]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKA
ALDAEFASLFD
3D structure
PDB4zm2 An intrinsically disordered entropic switch determines allostery in Phd-Doc regulation.
ChainB
Resolution3.88 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B R7 R30 R31 R7 R30 R31
BS02 dna B S14 R31 S14 R31
Gene Ontology
Molecular Function
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0043565 sequence-specific DNA binding
GO:0097351 toxin sequestering activity
Biological Process
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4zm2, PDBe:4zm2, PDBj:4zm2
PDBsum4zm2
PubMed27159580
UniProtQ06253|PHD_BPP1 Antitoxin phd (Gene Name=phd)

[Back to BioLiP]