Structure of PDB 4zlk Chain B

Receptor sequence
>4zlkB (length=133) Species: 10090 (Mus musculus) [Search protein sequence]
EQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD
ADGNGTIDFPEFLTMMASEEEIREAFRVFDKDGNGYISAAELRHVMTNLG
EKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
3D structure
PDB4zlk Structural basis for calcium regulation of myosin 5 motor function
ChainB
Resolution2.502 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) V35
Catalytic site (residue number reindexed from 1) V29
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CA B D20 D22 D24 T26 E31 D14 D16 D18 T20 E25
BS02 CA B D56 D58 N60 T62 E67 D50 D52 N54 T56 E61
BS03 CA B D93 D95 N97 Y99 E104 D80 D82 N84 Y86 E91
BS04 CA B D129 D131 D133 Q135 E140 D116 D118 D120 Q122 E127
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008179 adenylate cyclase binding
GO:0010856 adenylate cyclase activator activity
GO:0019855 calcium channel inhibitor activity
GO:0019901 protein kinase binding
GO:0031432 titin binding
GO:0043539 protein serine/threonine kinase activator activity
GO:0044325 transmembrane transporter binding
GO:0046872 metal ion binding
GO:0072542 protein phosphatase activator activity
Biological Process
GO:0000086 G2/M transition of mitotic cell cycle
GO:0002027 regulation of heart rate
GO:0005513 detection of calcium ion
GO:0010880 regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
GO:0016240 autophagosome membrane docking
GO:0032465 regulation of cytokinesis
GO:0035458 cellular response to interferon-beta
GO:0046427 positive regulation of receptor signaling pathway via JAK-STAT
GO:0051343 positive regulation of cyclic-nucleotide phosphodiesterase activity
GO:0051592 response to calcium ion
GO:0051649 establishment of localization in cell
GO:0055117 regulation of cardiac muscle contraction
GO:0060314 regulation of ryanodine-sensitive calcium-release channel activity
GO:0060315 negative regulation of ryanodine-sensitive calcium-release channel activity
GO:0060316 positive regulation of ryanodine-sensitive calcium-release channel activity
GO:0071346 cellular response to type II interferon
GO:0098901 regulation of cardiac muscle cell action potential
GO:0140056 organelle localization by membrane tethering
GO:0140238 presynaptic endocytosis
GO:1901842 negative regulation of high voltage-gated calcium channel activity
GO:1990456 mitochondrion-endoplasmic reticulum membrane tethering
Cellular Component
GO:0000922 spindle pole
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005819 spindle
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005876 spindle microtubule
GO:0008076 voltage-gated potassium channel complex
GO:0030017 sarcomere
GO:0031514 motile cilium
GO:0032991 protein-containing complex
GO:0034704 calcium channel complex
GO:0043209 myelin sheath
GO:0044305 calyx of Held
GO:0097225 sperm midpiece
GO:0150034 distal axon
GO:1902494 catalytic complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4zlk, PDBe:4zlk, PDBj:4zlk
PDBsum4zlk
PubMed
UniProtP0DP26|CALM1_MOUSE Calmodulin-1 (Gene Name=Calm1)

[Back to BioLiP]