Structure of PDB 4zb0 Chain B

Receptor sequence

>4zb0B (length=387) Species: 1929 (Streptomyces rubiginosus)

NYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVESVRRLAELGAHGV
TFHDDDLIPFGSSDSEREEHVKRFRQALDDTGMKVPMATTNLFTHPVFKD
GGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAESGGAKDV
RDALDRMKEAFDLLGEYVTSQGYDIRFAIEPKPNEPRGDILLPTVGHALA
FIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGKLFHIDLNGQNG
IKYDQDLRFGAGDLRAAFWLVDLLESAGYSGPRHFDFKPPRTEDFDGVWA
SAAGCMRNYLILKERAAAFRADPEVQEALRASRLDELARPTAADGLQALL
DDRSAFEEFDVDAAAARGMAFERLDQLAMDHLLGARG

3D structure

• PDB: 4zb0 A generic protocol for protein crystal dehydration using the HC1b humidity controller.
• Chain: B
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H54 D57 M88 E181 K183 E217 H220 D245 D255 D257 D287
• Catalytic site (residue number reindexed from 1): H53 D56 M87 E180 K182 E216 H219 D244 D254 D256 D286
• Enzyme Commision number: 5.3.1.5: xylose isomerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	B	E181 E217 D245 D287	E180 E216 D244 D286
BS02	MN	B	E217 H220 D255 D257	E216 H219 D254 D256
BS03	MN	B	T6 P7 D9 R10 F11 G47 A48 H49	T5 P6 D8 R9 F10 G46 A47 H48
BS04	MN	B	D101 T105 E141 G142 K149	D100 T104 E140 G141 K148
BS05	GLC	B	W16 H54 W137 E181 D287	W15 H53 W136 E180 D286
BS06	FRU	B	E337 R368	E336 R367

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0009045 xylose isomerase activity
• GO:0016853 isomerase activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0042732 D-xylose metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4zb0, PDBe:4zb0, PDBj:4zb0
• PDBsum: 4zb0
• PubMed: 27139626
• UniProt: P24300|XYLA_STRRU Xylose isomerase (Gene Name=xylA)