Structure of PDB 4z3d Chain B

Receptor sequence

>4z3dB (length=275) Species: 9606 (Homo sapiens) [Search protein sequence]

SGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQA
EGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTP
FHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSP
ELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVT
VLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPV
YLALLPPDAEGPHGQFVSEKRVEQW

3D structure

PDB

4z3d Structural insights on the catalytic site protection of human carbonyl reductase 1 by glutathione.

Chain

Resolution

1.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.1.1.184: carbonyl reductase (NADPH).
1.1.1.189: prostaglandin-E2 9-reductase.
1.1.1.196: 15-hydroxyprostaglandin-D dehydrogenase (NADP(+)).
1.1.1.197: 15-hydroxyprostaglandin dehydrogenase (NADP(+)).
1.1.1.71: alcohol dehydrogenase [NAD(P)(+)].

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GSH	B	F94 K95 V96 Q105 S139 M141 A192 Y193 M234 A235	F93 K94 V95 Q104 S138 M140 A191 Y192 M233 A234	MOAD: Ka=87200M^-1
BS02	NDP	B	G11 N13 K14 G15 I16 R37 D62 I63 D64 N89 A90 G91 I92 V137 S139 Y193 K197 P227 G228 W229 V230 T232 M234 A235	G10 N12 K13 G14 I15 R36 D61 I62 D63 N88 A89 G90 I91 V136 S138 Y192 K196 P226 G227 W228 V229 T231 M233 A234

Gene Ontology

	Molecular Function
GO:0004090	carbonyl reductase (NADPH) activity
GO:0005515	protein binding
GO:0008106	alcohol dehydrogenase (NADP+) activity
GO:0016491	oxidoreductase activity
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
GO:0047020	15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity
GO:0047021	15-hydroxyprostaglandin dehydrogenase (NADP+) activity
GO:0050221	prostaglandin E2 9-reductase activity
GO:0160163	S-nitrosoglutathione reductase (NADPH) activity

	Biological Process
GO:0006629	lipid metabolic process
GO:0006805	xenobiotic metabolic process
GO:0008211	glucocorticoid metabolic process
GO:0019371	cyclooxygenase pathway
GO:0030855	epithelial cell differentiation
GO:0042373	vitamin K metabolic process
GO:2000379	positive regulation of reactive oxygen species metabolic process

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0070062	extracellular exosome
GO:1903561	extracellular vesicle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4z3d, PDBe:4z3d, PDBj:4z3d
PDBsum	4z3d
PubMed	26381805
UniProt	P16152\|CBR1_HUMAN Carbonyl reductase [NADPH] 1 (Gene Name=CBR1)

[Back to BioLiP]