Structure of PDB 4z1s Chain B |
>4z1sB (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] |
GSTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAV KLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYN KPGDDIVLMAEALEKLFLQKINELP |
|
PDB | 4z1s Discovery of Benzotriazolo[4,3-d][1,4]diazepines as Orally Active Inhibitors of BET Bromodomains. |
Chain | B |
Resolution | 1.06 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
559 |
B |
W81 P82 L92 I146 |
W41 P42 L52 I106 |
MOAD: ic50=0.79uM |
|
|