Structure of PDB 4yyh Chain B |
>4yyhB (length=103) Species: 9606 (Homo sapiens) [Search protein sequence] |
ESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTM KDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKM MSK |
|
PDB | 4yyh A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications. |
Chain | B |
Resolution | 1.74 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
F45 Y99 N100 |
F25 Y79 N80 |
|
|
|